Anti IMP3 pAb (ATL-HPA061177)

Atlas Antibodies

Catalog No.:
ATL-HPA061177-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: IMP3, U3 small nucleolar ribonucleoprotein
Gene Name: IMP3
Alternative Gene Name: BRMS2, C15orf12, FLJ10968, MRPS4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032288: 96%, ENSRNOG00000017460: 96%
Entrez Gene ID: 55272
Uniprot ID: Q9NV31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE
Gene Sequence TRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE
Gene ID - Mouse ENSMUSG00000032288
Gene ID - Rat ENSRNOG00000017460
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IMP3 pAb (ATL-HPA061177)
Datasheet Anti IMP3 pAb (ATL-HPA061177) Datasheet (External Link)
Vendor Page Anti IMP3 pAb (ATL-HPA061177) at Atlas Antibodies

Documents & Links for Anti IMP3 pAb (ATL-HPA061177)
Datasheet Anti IMP3 pAb (ATL-HPA061177) Datasheet (External Link)
Vendor Page Anti IMP3 pAb (ATL-HPA061177)