Anti IMP3 pAb (ATL-HPA060955)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060955-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: IMP3
Alternative Gene Name: BRMS2, C15orf12, FLJ10968, MRPS4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032288: 96%, ENSRNOG00000017460: 96%
Entrez Gene ID: 55272
Uniprot ID: Q9NV31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPT |
| Gene Sequence | DFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPT |
| Gene ID - Mouse | ENSMUSG00000032288 |
| Gene ID - Rat | ENSRNOG00000017460 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IMP3 pAb (ATL-HPA060955) | |
| Datasheet | Anti IMP3 pAb (ATL-HPA060955) Datasheet (External Link) |
| Vendor Page | Anti IMP3 pAb (ATL-HPA060955) at Atlas Antibodies |
| Documents & Links for Anti IMP3 pAb (ATL-HPA060955) | |
| Datasheet | Anti IMP3 pAb (ATL-HPA060955) Datasheet (External Link) |
| Vendor Page | Anti IMP3 pAb (ATL-HPA060955) |