Anti IMP3 pAb (ATL-HPA060955)

Atlas Antibodies

Catalog No.: ATL-HPA060955-25

Protein Description: IMP3, U3 small nucleolar ribonucleoprotein
Gene Name: IMP3
Alternative Gene Name: BRMS2, C15orf12, FLJ10968, MRPS4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032288: 96%, ENSRNOG00000017460: 96%
Entrez Gene ID: 55272
Uniprot ID: Q9NV31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPT
• Gene Sequence: DFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPT
• Gene ID - Mouse: ENSMUSG00000032288
• Gene ID - Rat: ENSRNOG00000017460
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.