Anti ILK pAb (ATL-HPA048437)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048437-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ILK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030890: 99%, ENSRNOG00000018993: 99%
Entrez Gene ID: 3611
Uniprot ID: Q13418
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPR |
Gene Sequence | DLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPR |
Gene ID - Mouse | ENSMUSG00000030890 |
Gene ID - Rat | ENSRNOG00000018993 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ILK pAb (ATL-HPA048437) | |
Datasheet | Anti ILK pAb (ATL-HPA048437) Datasheet (External Link) |
Vendor Page | Anti ILK pAb (ATL-HPA048437) at Atlas Antibodies |
Documents & Links for Anti ILK pAb (ATL-HPA048437) | |
Datasheet | Anti ILK pAb (ATL-HPA048437) Datasheet (External Link) |
Vendor Page | Anti ILK pAb (ATL-HPA048437) |