Anti ILK pAb (ATL-HPA048437)

Atlas Antibodies

Catalog No.:
ATL-HPA048437-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: integrin-linked kinase
Gene Name: ILK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030890: 99%, ENSRNOG00000018993: 99%
Entrez Gene ID: 3611
Uniprot ID: Q13418
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPR
Gene Sequence DLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPR
Gene ID - Mouse ENSMUSG00000030890
Gene ID - Rat ENSRNOG00000018993
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ILK pAb (ATL-HPA048437)
Datasheet Anti ILK pAb (ATL-HPA048437) Datasheet (External Link)
Vendor Page Anti ILK pAb (ATL-HPA048437) at Atlas Antibodies

Documents & Links for Anti ILK pAb (ATL-HPA048437)
Datasheet Anti ILK pAb (ATL-HPA048437) Datasheet (External Link)
Vendor Page Anti ILK pAb (ATL-HPA048437)