Anti IL9R pAb (ATL-HPA063240)

Atlas Antibodies

Catalog No.:
ATL-HPA063240-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: interleukin 9 receptor
Gene Name: IL9R
Alternative Gene Name: CD129
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020279: 67%, ENSRNOG00000020630: 61%
Entrez Gene ID: 3581
Uniprot ID: Q01113
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRR
Gene Sequence LTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRR
Gene ID - Mouse ENSMUSG00000020279
Gene ID - Rat ENSRNOG00000020630
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IL9R pAb (ATL-HPA063240)
Datasheet Anti IL9R pAb (ATL-HPA063240) Datasheet (External Link)
Vendor Page Anti IL9R pAb (ATL-HPA063240) at Atlas Antibodies

Documents & Links for Anti IL9R pAb (ATL-HPA063240)
Datasheet Anti IL9R pAb (ATL-HPA063240) Datasheet (External Link)
Vendor Page Anti IL9R pAb (ATL-HPA063240)