Anti IL7R pAb (ATL-HPA067550)

Atlas Antibodies

Catalog No.:
ATL-HPA067550-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: interleukin 7 receptor
Gene Name: IL7R
Alternative Gene Name: CD127
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003882: 60%, ENSRNOG00000058446: 66%
Entrez Gene ID: 3575
Uniprot ID: P16871
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
Gene Sequence HKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
Gene ID - Mouse ENSMUSG00000003882
Gene ID - Rat ENSRNOG00000058446
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IL7R pAb (ATL-HPA067550)
Datasheet Anti IL7R pAb (ATL-HPA067550) Datasheet (External Link)
Vendor Page Anti IL7R pAb (ATL-HPA067550) at Atlas Antibodies

Documents & Links for Anti IL7R pAb (ATL-HPA067550)
Datasheet Anti IL7R pAb (ATL-HPA067550) Datasheet (External Link)
Vendor Page Anti IL7R pAb (ATL-HPA067550)