Anti IL7 pAb (ATL-HPA019590)

Atlas Antibodies

Catalog No.:
ATL-HPA019590-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: interleukin 7
Gene Name: IL7
Alternative Gene Name: IL-7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040329: 46%, ENSRNOG00000011973: 46%
Entrez Gene ID: 3574
Uniprot ID: P13232
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEI
Gene Sequence VSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEI
Gene ID - Mouse ENSMUSG00000040329
Gene ID - Rat ENSRNOG00000011973
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IL7 pAb (ATL-HPA019590)
Datasheet Anti IL7 pAb (ATL-HPA019590) Datasheet (External Link)
Vendor Page Anti IL7 pAb (ATL-HPA019590) at Atlas Antibodies

Documents & Links for Anti IL7 pAb (ATL-HPA019590)
Datasheet Anti IL7 pAb (ATL-HPA019590) Datasheet (External Link)
Vendor Page Anti IL7 pAb (ATL-HPA019590)
Citations for Anti IL7 pAb (ATL-HPA019590) – 2 Found
Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038.  PubMed
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed