Anti IL6ST pAb (ATL-HPA010558)

Atlas Antibodies

Catalog No.: ATL-HPA010558-25

Protein Description: interleukin 6 signal transducer
Gene Name: IL6ST
Alternative Gene Name: CD130, GP130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021756: 84%, ENSRNOG00000013963: 86%
Entrez Gene ID: 3572
Uniprot ID: P40189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEI
• Gene Sequence: CYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEI
• Gene ID - Mouse: ENSMUSG00000021756
• Gene ID - Rat: ENSRNOG00000013963
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IL6ST pAb (ATL-HPA010558) – 3 Found

Rognum, Ingvar Jon; Haynes, Robin L; Vege, Ashild; Yang, May; Rognum, Torleiv O; Kinney, Hannah C. Interleukin-6 and the serotonergic system of the medulla oblongata in the sudden infant death syndrome. Acta Neuropathologica. 2009;118(4):519-30. 

Chen, Yin-Huai; Grigelioniene, Giedre; Newton, Phillip T; Gullander, Jacob; Elfving, Maria; Hammarsjö, Anna; Batkovskyte, Dominyka; Alsaif, Hessa S; Kurdi, Wesam I Y; Abdulwahab, Firdous; Shanmugasundaram, Veerabahu; Devey, Luke; Bacrot, Séverine; Brodszki, Jana; Huber, Celine; Hamel, Ben; Gisselsson, David; Papadogiannakis, Nikos; Jedrycha, Katarina; Gürtl-Lackner, Barbara; Chagin, Andrei S; Nishimura, Gen; Aschenbrenner, Dominik; Alkuraya, Fowzan S; Laurence, Arian; Cormier-Daire, Valérie; Uhlig, Holm H. Absence of GP130 cytokine receptor signaling causes extended Stüve-Wiedemann syndrome. The Journal Of Experimental Medicine. 2020;217(3) 

Burkard, Tobias; Herrero San Juan, Martina; Dreis, Caroline; Kiprina, Anastasiia; Namgaladze, Dmitry; Siebenbrodt, Kai; Luger, Sebastian; Foerch, Christian; Pfeilschifter, Josef M; Weigert, Andreas; Radeke, Heinfried H. Differential expression of CD8 defines phenotypically distinct cytotoxic T cells in cancer and multiple sclerosis. Clinical And Translational Medicine. 2022;12(12):e1068.