Anti IL4R pAb (ATL-HPA070380)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070380-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: IL4R
Alternative Gene Name: CD124
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030748: 55%, ENSRNOG00000015441: 51%
Entrez Gene ID: 3566
Uniprot ID: P24394
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DNLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPTTVPQPEPETWEQILRRNVLQHGAAAAPVSAPTSGYQEFV |
| Gene Sequence | DNLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPTTVPQPEPETWEQILRRNVLQHGAAAAPVSAPTSGYQEFV |
| Gene ID - Mouse | ENSMUSG00000030748 |
| Gene ID - Rat | ENSRNOG00000015441 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IL4R pAb (ATL-HPA070380) | |
| Datasheet | Anti IL4R pAb (ATL-HPA070380) Datasheet (External Link) |
| Vendor Page | Anti IL4R pAb (ATL-HPA070380) at Atlas Antibodies |
| Documents & Links for Anti IL4R pAb (ATL-HPA070380) | |
| Datasheet | Anti IL4R pAb (ATL-HPA070380) Datasheet (External Link) |
| Vendor Page | Anti IL4R pAb (ATL-HPA070380) |