Anti IL4R pAb (ATL-HPA070380)

Atlas Antibodies

Catalog No.:
ATL-HPA070380-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: interleukin 4 receptor
Gene Name: IL4R
Alternative Gene Name: CD124
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030748: 55%, ENSRNOG00000015441: 51%
Entrez Gene ID: 3566
Uniprot ID: P24394
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DNLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPTTVPQPEPETWEQILRRNVLQHGAAAAPVSAPTSGYQEFV
Gene Sequence DNLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPTTVPQPEPETWEQILRRNVLQHGAAAAPVSAPTSGYQEFV
Gene ID - Mouse ENSMUSG00000030748
Gene ID - Rat ENSRNOG00000015441
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IL4R pAb (ATL-HPA070380)
Datasheet Anti IL4R pAb (ATL-HPA070380) Datasheet (External Link)
Vendor Page Anti IL4R pAb (ATL-HPA070380) at Atlas Antibodies

Documents & Links for Anti IL4R pAb (ATL-HPA070380)
Datasheet Anti IL4R pAb (ATL-HPA070380) Datasheet (External Link)
Vendor Page Anti IL4R pAb (ATL-HPA070380)