Anti IL3RA pAb (ATL-HPA003539)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003539-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: IL3RA
Alternative Gene Name: CD123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068758: 32%, ENSRNOG00000001325: 35%
Entrez Gene ID: 3563
Uniprot ID: P26951
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDIS |
| Gene Sequence | PPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDIS |
| Gene ID - Mouse | ENSMUSG00000068758 |
| Gene ID - Rat | ENSRNOG00000001325 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IL3RA pAb (ATL-HPA003539) | |
| Datasheet | Anti IL3RA pAb (ATL-HPA003539) Datasheet (External Link) |
| Vendor Page | Anti IL3RA pAb (ATL-HPA003539) at Atlas Antibodies |
| Documents & Links for Anti IL3RA pAb (ATL-HPA003539) | |
| Datasheet | Anti IL3RA pAb (ATL-HPA003539) Datasheet (External Link) |
| Vendor Page | Anti IL3RA pAb (ATL-HPA003539) |
| Citations for Anti IL3RA pAb (ATL-HPA003539) – 2 Found |
| De Mattos-Arruda, Leticia; Sammut, Stephen-John; Ross, Edith M; Bashford-Rogers, Rachael; Greenstein, Erez; Markus, Havell; Morganella, Sandro; Teng, Yvonne; Maruvka, Yosef; Pereira, Bernard; Rueda, Oscar M; Chin, Suet-Feung; Contente-Cuomo, Tania; Mayor, Regina; Arias, Alexandra; Ali, H Raza; Cope, Wei; Tiezzi, Daniel; Dariush, Aliakbar; Dias Amarante, Tauanne; Reshef, Dan; Ciriaco, Nikaoly; Martinez-Saez, Elena; Peg, Vicente; Ramon Y Cajal, Santiago; Cortes, Javier; Vassiliou, George; Getz, Gad; Nik-Zainal, Serena; Murtaza, Muhammed; Friedman, Nir; Markowetz, Florian; Seoane, Joan; Caldas, Carlos. The Genomic and Immune Landscapes of Lethal Metastatic Breast Cancer. Cell Reports. 2019;27(9):2690-2708.e10. PubMed |
| Mansfield, Aaron Scott; Heikkila, Paivi; von Smitten, Karl; Vakkila, Jukka; Leidenius, Marjut. Metastasis to sentinel lymph nodes in breast cancer is associated with maturation arrest of dendritic cells and poor co-localization of dendritic cells and CD8+ T cells. Virchows Archiv : An International Journal Of Pathology. 2011;459(4):391-8. PubMed |