Anti IL37 pAb (ATL-HPA057950)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057950-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: IL37
Alternative Gene Name: FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H4, IL-1RP1, IL1F7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090272: 24%, ENSRNOG00000032948: 24%
Entrez Gene ID: 27178
Uniprot ID: Q9NZH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ENSGVKMGSEDWEKDEPQCCLEDPAVSPLEPGPSLPAMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALA |
| Gene Sequence | ENSGVKMGSEDWEKDEPQCCLEDPAVSPLEPGPSLPAMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALA |
| Gene ID - Mouse | ENSMUSG00000090272 |
| Gene ID - Rat | ENSRNOG00000032948 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IL37 pAb (ATL-HPA057950) | |
| Datasheet | Anti IL37 pAb (ATL-HPA057950) Datasheet (External Link) |
| Vendor Page | Anti IL37 pAb (ATL-HPA057950) at Atlas Antibodies |
| Documents & Links for Anti IL37 pAb (ATL-HPA057950) | |
| Datasheet | Anti IL37 pAb (ATL-HPA057950) Datasheet (External Link) |
| Vendor Page | Anti IL37 pAb (ATL-HPA057950) |