Anti IL37 pAb (ATL-HPA057950)

Atlas Antibodies

SKU: ATL-HPA057950-25

• 
• 

Protein Description: interleukin 37
Gene Name: IL37
Alternative Gene Name: FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H4, IL-1RP1, IL1F7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090272: 24%, ENSRNOG00000032948: 24%
Entrez Gene ID: 27178
Uniprot ID: Q9NZH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ENSGVKMGSEDWEKDEPQCCLEDPAVSPLEPGPSLPAMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALA
• Gene Sequence: ENSGVKMGSEDWEKDEPQCCLEDPAVSPLEPGPSLPAMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALA
• Gene ID - Mouse: ENSMUSG00000090272
• Gene ID - Rat: ENSRNOG00000032948
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.