Anti IL33 pAb (ATL-HPA024426)

Atlas Antibodies

Catalog No.: ATL-HPA024426-25

Protein Description: interleukin 33
Gene Name: IL33
Alternative Gene Name: C9orf26, DKFZp586H0523, DVS27, IL1F11, NF-HEV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024810: 43%, ENSRNOG00000016456: 44%
Entrez Gene ID: 90865
Uniprot ID: O95760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDG
• Gene Sequence: STVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDG
• Gene ID - Mouse: ENSMUSG00000024810
• Gene ID - Rat: ENSRNOG00000016456
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IL33 pAb (ATL-HPA024426) – 2 Found

Zeyda, M; Wernly, B; Demyanets, S; Kaun, C; Hämmerle, M; Hantusch, B; Schranz, M; Neuhofer, A; Itariu, B K; Keck, M; Prager, G; Wojta, J; Stulnig, T M. Severe obesity increases adipose tissue expression of interleukin-33 and its receptor ST2, both predominantly detectable in endothelial cells of human adipose tissue. International Journal Of Obesity (2005). 2013;37(5):658-65. 

Saranchova, Iryna; Han, Jeffrey; Huang, Hui; Fenninger, Franz; Choi, Kyung Bok; Munro, Lonna; Pfeifer, Cheryl; Welch, Ian; Wyatt, Alexander W; Fazli, Ladan; Gleave, Martin E; Jefferies, Wilfred A. Discovery of a Metastatic Immune Escape Mechanism Initiated by the Loss of Expression of the Tumour Biomarker Interleukin-33. Scientific Reports. 2016;6( 27619158):30555.