Anti IL33 pAb (ATL-HPA024426)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024426-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: IL33
Alternative Gene Name: C9orf26, DKFZp586H0523, DVS27, IL1F11, NF-HEV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024810: 43%, ENSRNOG00000016456: 44%
Entrez Gene ID: 90865
Uniprot ID: O95760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | STVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDG |
| Gene Sequence | STVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDG |
| Gene ID - Mouse | ENSMUSG00000024810 |
| Gene ID - Rat | ENSRNOG00000016456 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IL33 pAb (ATL-HPA024426) | |
| Datasheet | Anti IL33 pAb (ATL-HPA024426) Datasheet (External Link) |
| Vendor Page | Anti IL33 pAb (ATL-HPA024426) at Atlas Antibodies |
| Documents & Links for Anti IL33 pAb (ATL-HPA024426) | |
| Datasheet | Anti IL33 pAb (ATL-HPA024426) Datasheet (External Link) |
| Vendor Page | Anti IL33 pAb (ATL-HPA024426) |
| Citations for Anti IL33 pAb (ATL-HPA024426) – 2 Found |
| Zeyda, M; Wernly, B; Demyanets, S; Kaun, C; Hämmerle, M; Hantusch, B; Schranz, M; Neuhofer, A; Itariu, B K; Keck, M; Prager, G; Wojta, J; Stulnig, T M. Severe obesity increases adipose tissue expression of interleukin-33 and its receptor ST2, both predominantly detectable in endothelial cells of human adipose tissue. International Journal Of Obesity (2005). 2013;37(5):658-65. PubMed |
| Saranchova, Iryna; Han, Jeffrey; Huang, Hui; Fenninger, Franz; Choi, Kyung Bok; Munro, Lonna; Pfeifer, Cheryl; Welch, Ian; Wyatt, Alexander W; Fazli, Ladan; Gleave, Martin E; Jefferies, Wilfred A. Discovery of a Metastatic Immune Escape Mechanism Initiated by the Loss of Expression of the Tumour Biomarker Interleukin-33. Scientific Reports. 2016;6( 27619158):30555. PubMed |