Anti IL31RA pAb (ATL-HPA068114)

Atlas Antibodies

Catalog No.: ATL-HPA068114-25

Protein Description: interleukin 31 receptor A
Gene Name: IL31RA
Alternative Gene Name: CRL, CRL3, GLM-R, Glmr, IL-31RA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050377: 52%, ENSRNOG00000042080: 51%
Entrez Gene ID: 133396
Uniprot ID: Q8NI17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLR
• Gene Sequence: ILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLR
• Gene ID - Mouse: ENSMUSG00000050377
• Gene ID - Rat: ENSRNOG00000042080
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.