Anti IL31RA pAb (ATL-HPA068114)

Atlas Antibodies

Catalog No.:
ATL-HPA068114-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: interleukin 31 receptor A
Gene Name: IL31RA
Alternative Gene Name: CRL, CRL3, GLM-R, Glmr, IL-31RA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050377: 52%, ENSRNOG00000042080: 51%
Entrez Gene ID: 133396
Uniprot ID: Q8NI17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLR
Gene Sequence ILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLR
Gene ID - Mouse ENSMUSG00000050377
Gene ID - Rat ENSRNOG00000042080
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IL31RA pAb (ATL-HPA068114)
Datasheet Anti IL31RA pAb (ATL-HPA068114) Datasheet (External Link)
Vendor Page Anti IL31RA pAb (ATL-HPA068114) at Atlas Antibodies

Documents & Links for Anti IL31RA pAb (ATL-HPA068114)
Datasheet Anti IL31RA pAb (ATL-HPA068114) Datasheet (External Link)
Vendor Page Anti IL31RA pAb (ATL-HPA068114)