Anti IL31RA pAb (ATL-HPA068114)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068114-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: IL31RA
Alternative Gene Name: CRL, CRL3, GLM-R, Glmr, IL-31RA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050377: 52%, ENSRNOG00000042080: 51%
Entrez Gene ID: 133396
Uniprot ID: Q8NI17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLR |
| Gene Sequence | ILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLR |
| Gene ID - Mouse | ENSMUSG00000050377 |
| Gene ID - Rat | ENSRNOG00000042080 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IL31RA pAb (ATL-HPA068114) | |
| Datasheet | Anti IL31RA pAb (ATL-HPA068114) Datasheet (External Link) |
| Vendor Page | Anti IL31RA pAb (ATL-HPA068114) at Atlas Antibodies |
| Documents & Links for Anti IL31RA pAb (ATL-HPA068114) | |
| Datasheet | Anti IL31RA pAb (ATL-HPA068114) Datasheet (External Link) |
| Vendor Page | Anti IL31RA pAb (ATL-HPA068114) |