Anti IL2RB pAb (ATL-HPA062657 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA062657-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: interleukin 2 receptor, beta
Gene Name: IL2RB
Alternative Gene Name: CD122, IL15RB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068227: 53%, ENSRNOG00000048636: 60%
Entrez Gene ID: 3560
Uniprot ID: P14784
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQ
Gene Sequence DRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQ
Gene ID - Mouse ENSMUSG00000068227
Gene ID - Rat ENSRNOG00000048636
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IL2RB pAb (ATL-HPA062657 w/enhanced validation)
Datasheet Anti IL2RB pAb (ATL-HPA062657 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IL2RB pAb (ATL-HPA062657 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti IL2RB pAb (ATL-HPA062657 w/enhanced validation)
Datasheet Anti IL2RB pAb (ATL-HPA062657 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IL2RB pAb (ATL-HPA062657 w/enhanced validation)