Anti IL27RA pAb (ATL-HPA073441)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073441-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: IL27RA
Alternative Gene Name: CRL1, IL-27R, TCCR, WSX-1, WSX1, zcytor1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005465: 65%, ENSRNOG00000005747: 65%
Entrez Gene ID: 9466
Uniprot ID: Q6UWB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNL |
| Gene Sequence | QCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNL |
| Gene ID - Mouse | ENSMUSG00000005465 |
| Gene ID - Rat | ENSRNOG00000005747 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IL27RA pAb (ATL-HPA073441) | |
| Datasheet | Anti IL27RA pAb (ATL-HPA073441) Datasheet (External Link) |
| Vendor Page | Anti IL27RA pAb (ATL-HPA073441) at Atlas Antibodies |
| Documents & Links for Anti IL27RA pAb (ATL-HPA073441) | |
| Datasheet | Anti IL27RA pAb (ATL-HPA073441) Datasheet (External Link) |
| Vendor Page | Anti IL27RA pAb (ATL-HPA073441) |