Anti IL27RA pAb (ATL-HPA073441)

Atlas Antibodies

SKU: ATL-HPA073441-25

• 

Protein Description: interleukin 27 receptor subunit alpha
Gene Name: IL27RA
Alternative Gene Name: CRL1, IL-27R, TCCR, WSX-1, WSX1, zcytor1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005465: 65%, ENSRNOG00000005747: 65%
Entrez Gene ID: 9466
Uniprot ID: Q6UWB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNL
• Gene Sequence: QCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNL
• Gene ID - Mouse: ENSMUSG00000005465
• Gene ID - Rat: ENSRNOG00000005747
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.