Anti IL22RA2 pAb (ATL-HPA030582 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030582-25

Protein Description: interleukin 22 receptor, alpha 2
Gene Name: IL22RA2
Alternative Gene Name: CRF2-S1, IL-22BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039760: 75%, ENSRNOG00000012259: 73%
Entrez Gene ID: 116379
Uniprot ID: Q969J5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
• Gene Sequence: PNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
• Gene ID - Mouse: ENSMUSG00000039760
• Gene ID - Rat: ENSRNOG00000012259
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IL22RA2 pAb (ATL-HPA030582 w/enhanced validation) – 1 Found

Laaksonen, H; Guerreiro-Cacais, A O; Adzemovic, M Z; Parsa, R; Zeitelhofer, M; Jagodic, M; Olsson, T. The multiple sclerosis risk gene IL22RA2 contributes to a more severe murine autoimmune neuroinflammation. Genes And Immunity. 2014;15(7):457-65.