Anti IL20RB pAb (ATL-HPA063914)

Atlas Antibodies

Catalog No.: ATL-HPA063914-25

Protein Description: interleukin 20 receptor subunit beta
Gene Name: IL20RB
Alternative Gene Name: DIRS1, FNDC6, IL-20R2, MGC34923
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044244: 85%, ENSRNOG00000023214: 76%
Entrez Gene ID: 53833
Uniprot ID: Q6UXL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGE
• Gene Sequence: QFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGE
• Gene ID - Mouse: ENSMUSG00000044244
• Gene ID - Rat: ENSRNOG00000023214
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.