Anti IL1R2 pAb (ATL-HPA027598 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA027598-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: interleukin 1 receptor, type II
Gene Name: IL1R2
Alternative Gene Name: CD121b, IL1RB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026073: 64%, ENSRNOG00000014378: 64%
Entrez Gene ID: 7850
Uniprot ID: P27930
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDK
Gene Sequence GALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDK
Gene ID - Mouse ENSMUSG00000026073
Gene ID - Rat ENSRNOG00000014378
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IL1R2 pAb (ATL-HPA027598 w/enhanced validation)
Datasheet Anti IL1R2 pAb (ATL-HPA027598 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IL1R2 pAb (ATL-HPA027598 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti IL1R2 pAb (ATL-HPA027598 w/enhanced validation)
Datasheet Anti IL1R2 pAb (ATL-HPA027598 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IL1R2 pAb (ATL-HPA027598 w/enhanced validation)
Citations for Anti IL1R2 pAb (ATL-HPA027598 w/enhanced validation) – 1 Found
Sparreman Mikus, Maria; Kolmert, Johan; Andersson, Lars I; Östling, Jörgen; Knowles, Richard G; Gómez, Cristina; Ericsson, Magnus; Thörngren, John-Olof; Emami Khoonsari, Payam; Dahlén, Barbro; Kupczyk, Maciej; De Meulder, Bertrand; Auffray, Charles; Bakke, Per S; Beghe, Bianca; Bel, Elisabeth H; Caruso, Massimo; Chanez, Pascal; Chawes, Bo; Fowler, Stephen J; Gaga, Mina; Geiser, Thomas; Gjomarkaj, Mark; Horváth, Ildikó; Howarth, Peter H; Johnston, Sebastian L; Joos, Guy; Krug, Norbert; Montuschi, Paolo; Musial, Jacek; Niżankowska-Mogilnicka, Ewa; Olsson, Henric K; Papi, Alberto; Rabe, Klaus F; Sandström, Thomas; Shaw, Dominick E; Siafakas, Nikolaos M; Uhlén, Mathias; Riley, John H; Bates, Stewart; Middelveld, Roelinde J M; Wheelock, Craig E; Chung, Kian Fan; Adcock, Ian M; Sterk, Peter J; Djukanovic, Ratko; Nilsson, Peter; Dahlén, Sven-Erik; James, Anna. Plasma proteins elevated in severe asthma despite oral steroid use and unrelated to Type-2 inflammation. The European Respiratory Journal. 2022;59(2)  PubMed