Anti IL1R2 pAb (ATL-HPA027597)

Atlas Antibodies

Catalog No.: ATL-HPA027597-25

Protein Description: interleukin 1 receptor, type II
Gene Name: IL1R2
Alternative Gene Name: CD121b, IL1RB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026073: 48%, ENSRNOG00000014378: 54%
Entrez Gene ID: 7850
Uniprot ID: P27930
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQD
• Gene Sequence: AARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQD
• Gene ID - Mouse: ENSMUSG00000026073
• Gene ID - Rat: ENSRNOG00000014378
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.