Anti IL17RE pAb (ATL-HPA019011)

Atlas Antibodies

Catalog No.: ATL-HPA019011-25

Protein Description: interleukin 17 receptor E
Gene Name: IL17RE
Alternative Gene Name: FLJ23658
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043088: 77%, ENSRNOG00000009204: 75%
Entrez Gene ID: 132014
Uniprot ID: Q8NFR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKSHHISIPSPDISHKGLRSKRTQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPEVSVRLCHQWALECEELSSPYDVQKIVSGGHTVELPYEFLLPCLCMEASYLQEDTVRRKKCPFQSWPEAYGSDFWKSVHFTDYS
• Gene Sequence: EKSHHISIPSPDISHKGLRSKRTQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPEVSVRLCHQWALECEELSSPYDVQKIVSGGHTVELPYEFLLPCLCMEASYLQEDTVRRKKCPFQSWPEAYGSDFWKSVHFTDYS
• Gene ID - Mouse: ENSMUSG00000043088
• Gene ID - Rat: ENSRNOG00000009204
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IL17RE pAb (ATL-HPA019011) – 1 Found

Tanaka, Shingo; Nagashima, Hiroyuki; Cruz, Modesto; Uchida, Tomohisa; Uotani, Takahiro; Jiménez Abreu, José A; Mahachai, Varocha; Vilaichone, Ratha-Korn; Ratanachu-Ek, Thawee; Tshering, Lotay; Graham, David Y; Yamaoka, Yoshio. Interleukin-17C in Human Helicobacter pylori Gastritis. Infection And Immunity. 2017;85(10)