Anti IL17B pAb (ATL-HPA042441)

Atlas Antibodies

Catalog No.: ATL-HPA042441-25

Protein Description: interleukin 17B
Gene Name: IL17B
Alternative Gene Name: IL-17B, IL-20, MGC138900, MGC138901, NIRF, ZCYTO7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024578: 87%, ENSRNOG00000019695: 88%
Entrez Gene ID: 27190
Uniprot ID: Q9UHF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGY
• Gene Sequence: PRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGY
• Gene ID - Mouse: ENSMUSG00000024578
• Gene ID - Rat: ENSRNOG00000019695
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.