Anti IL16 pAb (ATL-HPA048861)

Atlas Antibodies

SKU:
ATL-HPA048861-25
  • Immunofluorescent staining of human cell line HEL shows localization to nuclear speckles.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: interleukin 16
Gene Name: IL16
Alternative Gene Name: FLJ16806, FLJ42735, HsT19289, IL-16, LCF, prIL-16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001741: 73%, ENSRNOG00000011680: 75%
Entrez Gene ID: 3603
Uniprot ID: Q14005
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSPSASAGCPGPGIGPQTKSSTEGEPGWRRASPVTQTSPIKHPLLKRQARMDYSFDTTAEDPWVRISDCIKNLFSPIMSENHGHMPLQPNASLNEEEGTQGHPDGTPPKLD
Gene Sequence RSPSASAGCPGPGIGPQTKSSTEGEPGWRRASPVTQTSPIKHPLLKRQARMDYSFDTTAEDPWVRISDCIKNLFSPIMSENHGHMPLQPNASLNEEEGTQGHPDGTPPKLD
Gene ID - Mouse ENSMUSG00000001741
Gene ID - Rat ENSRNOG00000011680
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti IL16 pAb (ATL-HPA048861)
Datasheet Anti IL16 pAb (ATL-HPA048861) Datasheet (External Link)
Vendor Page Anti IL16 pAb (ATL-HPA048861) at Atlas Antibodies

Documents & Links for Anti IL16 pAb (ATL-HPA048861)
Datasheet Anti IL16 pAb (ATL-HPA048861) Datasheet (External Link)
Vendor Page Anti IL16 pAb (ATL-HPA048861)