Anti IL16 pAb (ATL-HPA018467 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA018467-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: interleukin 16
Gene Name: IL16
Alternative Gene Name: FLJ16806, FLJ42735, HsT19289, IL-16, LCF, prIL-16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001741: 76%, ENSRNOG00000011680: 74%
Entrez Gene ID: 3603
Uniprot ID: Q14005
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDG
Gene Sequence QRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDG
Gene ID - Mouse ENSMUSG00000001741
Gene ID - Rat ENSRNOG00000011680
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IL16 pAb (ATL-HPA018467 w/enhanced validation)
Datasheet Anti IL16 pAb (ATL-HPA018467 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IL16 pAb (ATL-HPA018467 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti IL16 pAb (ATL-HPA018467 w/enhanced validation)
Datasheet Anti IL16 pAb (ATL-HPA018467 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IL16 pAb (ATL-HPA018467 w/enhanced validation)
Citations for Anti IL16 pAb (ATL-HPA018467 w/enhanced validation) – 3 Found
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed
Purzycka-Bohdan, Dorota; Szczerkowska-Dobosz, Aneta; Zablotna, Monika; Wierzbicka, Justyna; Piotrowska, Anna; Zmijewski, Michal A; Nedoszytko, Boguslaw; Nowicki, Roman. Assessment of Interleukin 16 Serum Levels and Skin Expression in Psoriasis Patients in Correlation with Clinical Severity of the Disease. Plos One. 11(10):e0165577.  PubMed
Niewold, Timothy B; Meves, Alexander; Lehman, Julia S; Popovic-Silwerfeldt, Karin; Häyry, Aliisa; Söderlund-Matell, Therese; Charlesworth, Cristine M; Madden, Benjamin; Lundberg, Ingrid E; Wahren-Herlenius, Marie; Svenungsson, Elisabet; Oke, Vilija. Proteome study of cutaneous lupus erythematosus (CLE) and dermatomyositis skin lesions reveals IL-16 is differentially upregulated in CLE. Arthritis Research & Therapy. 2021;23(1):132.  PubMed