Anti IL16 pAb (ATL-HPA018467 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018467-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: IL16
Alternative Gene Name: FLJ16806, FLJ42735, HsT19289, IL-16, LCF, prIL-16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001741: 76%, ENSRNOG00000011680: 74%
Entrez Gene ID: 3603
Uniprot ID: Q14005
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDG |
| Gene Sequence | QRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDG |
| Gene ID - Mouse | ENSMUSG00000001741 |
| Gene ID - Rat | ENSRNOG00000011680 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IL16 pAb (ATL-HPA018467 w/enhanced validation) | |
| Datasheet | Anti IL16 pAb (ATL-HPA018467 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti IL16 pAb (ATL-HPA018467 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti IL16 pAb (ATL-HPA018467 w/enhanced validation) | |
| Datasheet | Anti IL16 pAb (ATL-HPA018467 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti IL16 pAb (ATL-HPA018467 w/enhanced validation) |
| Citations for Anti IL16 pAb (ATL-HPA018467 w/enhanced validation) – 3 Found |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |
| Purzycka-Bohdan, Dorota; Szczerkowska-Dobosz, Aneta; Zablotna, Monika; Wierzbicka, Justyna; Piotrowska, Anna; Zmijewski, Michal A; Nedoszytko, Boguslaw; Nowicki, Roman. Assessment of Interleukin 16 Serum Levels and Skin Expression in Psoriasis Patients in Correlation with Clinical Severity of the Disease. Plos One. 11(10):e0165577. PubMed |
| Niewold, Timothy B; Meves, Alexander; Lehman, Julia S; Popovic-Silwerfeldt, Karin; Häyry, Aliisa; Söderlund-Matell, Therese; Charlesworth, Cristine M; Madden, Benjamin; Lundberg, Ingrid E; Wahren-Herlenius, Marie; Svenungsson, Elisabet; Oke, Vilija. Proteome study of cutaneous lupus erythematosus (CLE) and dermatomyositis skin lesions reveals IL-16 is differentially upregulated in CLE. Arthritis Research & Therapy. 2021;23(1):132. PubMed |