Anti IL15 pAb (ATL-HPA037738)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037738-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: IL15
Alternative Gene Name: IL-15, MGC9721
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031712: 65%, ENSRNOG00000003439: 67%
Entrez Gene ID: 3600
Uniprot ID: P40933
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Gene Sequence | VISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Gene ID - Mouse | ENSMUSG00000031712 |
| Gene ID - Rat | ENSRNOG00000003439 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IL15 pAb (ATL-HPA037738) | |
| Datasheet | Anti IL15 pAb (ATL-HPA037738) Datasheet (External Link) |
| Vendor Page | Anti IL15 pAb (ATL-HPA037738) at Atlas Antibodies |
| Documents & Links for Anti IL15 pAb (ATL-HPA037738) | |
| Datasheet | Anti IL15 pAb (ATL-HPA037738) Datasheet (External Link) |
| Vendor Page | Anti IL15 pAb (ATL-HPA037738) |
| Citations for Anti IL15 pAb (ATL-HPA037738) – 2 Found |
| Hamsten, Carl; Wiklundh, Emil; Grönlund, Hans; Schwenk, Jochen M; Uhlén, Mathias; Eklund, Anders; Nilsson, Peter; Grunewald, Johan; Häggmark-Månberg, Anna. Elevated levels of FN1 and CCL2 in bronchoalveolar lavage fluid from sarcoidosis patients. Respiratory Research. 2016;17(1):69. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |