Anti IL15 pAb (ATL-HPA037738)

Atlas Antibodies

Catalog No.: ATL-HPA037738-25

Protein Description: interleukin 15
Gene Name: IL15
Alternative Gene Name: IL-15, MGC9721
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031712: 65%, ENSRNOG00000003439: 67%
Entrez Gene ID: 3600
Uniprot ID: P40933
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
• Gene Sequence: VISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
• Gene ID - Mouse: ENSMUSG00000031712
• Gene ID - Rat: ENSRNOG00000003439
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IL15 pAb (ATL-HPA037738) – 2 Found

Hamsten, Carl; Wiklundh, Emil; Grönlund, Hans; Schwenk, Jochen M; Uhlén, Mathias; Eklund, Anders; Nilsson, Peter; Grunewald, Johan; Häggmark-Månberg, Anna. Elevated levels of FN1 and CCL2 in bronchoalveolar lavage fluid from sarcoidosis patients. Respiratory Research. 2016;17(1):69. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.