Anti IL13RA2 pAb (ATL-HPA045831)

Atlas Antibodies

Catalog No.:
ATL-HPA045831-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: interleukin 13 receptor subunit alpha 2
Gene Name: IL13RA2
Alternative Gene Name: CD213a2, CT19, IL-13R, IL13BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031289: 73%, ENSRNOG00000032973: 74%
Entrez Gene ID: 3598
Uniprot ID: Q14627
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQS
Gene Sequence YLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQS
Gene ID - Mouse ENSMUSG00000031289
Gene ID - Rat ENSRNOG00000032973
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IL13RA2 pAb (ATL-HPA045831)
Datasheet Anti IL13RA2 pAb (ATL-HPA045831) Datasheet (External Link)
Vendor Page Anti IL13RA2 pAb (ATL-HPA045831) at Atlas Antibodies

Documents & Links for Anti IL13RA2 pAb (ATL-HPA045831)
Datasheet Anti IL13RA2 pAb (ATL-HPA045831) Datasheet (External Link)
Vendor Page Anti IL13RA2 pAb (ATL-HPA045831)