Anti IL12RB1 pAb (ATL-HPA074414)

Atlas Antibodies

Catalog No.:
ATL-HPA074414-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: interleukin 12 receptor, beta 1
Gene Name: IL12RB1
Alternative Gene Name: CD212, IL12RB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111872: 45%, ENSRNOG00000019216: 46%
Entrez Gene ID: 3594
Uniprot ID: P42701
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVES
Gene Sequence TSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVES
Gene ID - Mouse ENSMUSG00000111872
Gene ID - Rat ENSRNOG00000019216
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IL12RB1 pAb (ATL-HPA074414)
Datasheet Anti IL12RB1 pAb (ATL-HPA074414) Datasheet (External Link)
Vendor Page Anti IL12RB1 pAb (ATL-HPA074414) at Atlas Antibodies

Documents & Links for Anti IL12RB1 pAb (ATL-HPA074414)
Datasheet Anti IL12RB1 pAb (ATL-HPA074414) Datasheet (External Link)
Vendor Page Anti IL12RB1 pAb (ATL-HPA074414)