Anti IL10RA pAb (ATL-HPA069086)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069086-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: IL10RA
Alternative Gene Name: CD210, CD210a, CDW210A, HIL-10R, IL10R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032089: 69%, ENSRNOG00000016308: 70%
Entrez Gene ID: 3587
Uniprot ID: Q13651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSYDL |
| Gene Sequence | HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSYDL |
| Gene ID - Mouse | ENSMUSG00000032089 |
| Gene ID - Rat | ENSRNOG00000016308 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IL10RA pAb (ATL-HPA069086) | |
| Datasheet | Anti IL10RA pAb (ATL-HPA069086) Datasheet (External Link) |
| Vendor Page | Anti IL10RA pAb (ATL-HPA069086) at Atlas Antibodies |
| Documents & Links for Anti IL10RA pAb (ATL-HPA069086) | |
| Datasheet | Anti IL10RA pAb (ATL-HPA069086) Datasheet (External Link) |
| Vendor Page | Anti IL10RA pAb (ATL-HPA069086) |