Anti IL10RA pAb (ATL-HPA069086)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069086-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: IL10RA
Alternative Gene Name: CD210, CD210a, CDW210A, HIL-10R, IL10R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032089: 69%, ENSRNOG00000016308: 70%
Entrez Gene ID: 3587
Uniprot ID: Q13651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSYDL |
Gene Sequence | HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSYDL |
Gene ID - Mouse | ENSMUSG00000032089 |
Gene ID - Rat | ENSRNOG00000016308 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IL10RA pAb (ATL-HPA069086) | |
Datasheet | Anti IL10RA pAb (ATL-HPA069086) Datasheet (External Link) |
Vendor Page | Anti IL10RA pAb (ATL-HPA069086) at Atlas Antibodies |
Documents & Links for Anti IL10RA pAb (ATL-HPA069086) | |
Datasheet | Anti IL10RA pAb (ATL-HPA069086) Datasheet (External Link) |
Vendor Page | Anti IL10RA pAb (ATL-HPA069086) |