Anti IL10 pAb (ATL-HPA071391)

Atlas Antibodies

Catalog No.: ATL-HPA071391-25

Protein Description: interleukin 10
Gene Name: IL10
Alternative Gene Name: CSIF, IL-10, IL10A, TGIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016529: 78%, ENSRNOG00000004647: 80%
Entrez Gene ID: 3586
Uniprot ID: P22301
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
• Gene Sequence: ENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
• Gene ID - Mouse: ENSMUSG00000016529
• Gene ID - Rat: ENSRNOG00000004647
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.