Anti IL10 pAb (ATL-HPA071391)

Atlas Antibodies

Catalog No.:
ATL-HPA071391-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: interleukin 10
Gene Name: IL10
Alternative Gene Name: CSIF, IL-10, IL10A, TGIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016529: 78%, ENSRNOG00000004647: 80%
Entrez Gene ID: 3586
Uniprot ID: P22301
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Gene Sequence ENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Gene ID - Mouse ENSMUSG00000016529
Gene ID - Rat ENSRNOG00000004647
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IL10 pAb (ATL-HPA071391)
Datasheet Anti IL10 pAb (ATL-HPA071391) Datasheet (External Link)
Vendor Page Anti IL10 pAb (ATL-HPA071391) at Atlas Antibodies

Documents & Links for Anti IL10 pAb (ATL-HPA071391)
Datasheet Anti IL10 pAb (ATL-HPA071391) Datasheet (External Link)
Vendor Page Anti IL10 pAb (ATL-HPA071391)