Anti IL10 pAb (ATL-HPA071391)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071391-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: IL10
Alternative Gene Name: CSIF, IL-10, IL10A, TGIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016529: 78%, ENSRNOG00000004647: 80%
Entrez Gene ID: 3586
Uniprot ID: P22301
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |
| Gene Sequence | ENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |
| Gene ID - Mouse | ENSMUSG00000016529 |
| Gene ID - Rat | ENSRNOG00000004647 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IL10 pAb (ATL-HPA071391) | |
| Datasheet | Anti IL10 pAb (ATL-HPA071391) Datasheet (External Link) |
| Vendor Page | Anti IL10 pAb (ATL-HPA071391) at Atlas Antibodies |
| Documents & Links for Anti IL10 pAb (ATL-HPA071391) | |
| Datasheet | Anti IL10 pAb (ATL-HPA071391) Datasheet (External Link) |
| Vendor Page | Anti IL10 pAb (ATL-HPA071391) |