Anti IKBKAP pAb (ATL-HPA050686)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050686-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: IKBKAP
Alternative Gene Name: DYS, ELP1, IKAP, IKI3, TOT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028431: 80%, ENSRNOG00000016725: 77%
Entrez Gene ID: 8518
Uniprot ID: O95163
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RLHVLCQGWHYLAYDWHWTTDRSVGDNSSDLSNVAVIDGNRVLVTVFRQTVVPPPMCTYQLLFPHPVNQVTFLAHPQKSNDLAVLDASNQISVYKCGDCPSADPTVKLGAVG |
| Gene Sequence | RLHVLCQGWHYLAYDWHWTTDRSVGDNSSDLSNVAVIDGNRVLVTVFRQTVVPPPMCTYQLLFPHPVNQVTFLAHPQKSNDLAVLDASNQISVYKCGDCPSADPTVKLGAVG |
| Gene ID - Mouse | ENSMUSG00000028431 |
| Gene ID - Rat | ENSRNOG00000016725 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IKBKAP pAb (ATL-HPA050686) | |
| Datasheet | Anti IKBKAP pAb (ATL-HPA050686) Datasheet (External Link) |
| Vendor Page | Anti IKBKAP pAb (ATL-HPA050686) at Atlas Antibodies |
| Documents & Links for Anti IKBKAP pAb (ATL-HPA050686) | |
| Datasheet | Anti IKBKAP pAb (ATL-HPA050686) Datasheet (External Link) |
| Vendor Page | Anti IKBKAP pAb (ATL-HPA050686) |