Anti IGSF8 pAb (ATL-HPA075970)

Atlas Antibodies

Catalog No.: ATL-HPA075970-25

Protein Description: immunoglobulin superfamily member 8
Gene Name: IGSF8
Alternative Gene Name: CD316, CD81P3, EWI2, PGRL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038034: 96%, ENSRNOG00000007604: 96%
Entrez Gene ID: 93185
Uniprot ID: Q969P0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVRE
• Gene Sequence: RLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVRE
• Gene ID - Mouse: ENSMUSG00000038034
• Gene ID - Rat: ENSRNOG00000007604
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.