Anti IGSF8 pAb (ATL-HPA075970)

Atlas Antibodies

Catalog No.:
ATL-HPA075970-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: immunoglobulin superfamily member 8
Gene Name: IGSF8
Alternative Gene Name: CD316, CD81P3, EWI2, PGRL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038034: 96%, ENSRNOG00000007604: 96%
Entrez Gene ID: 93185
Uniprot ID: Q969P0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVRE
Gene Sequence RLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVRE
Gene ID - Mouse ENSMUSG00000038034
Gene ID - Rat ENSRNOG00000007604
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IGSF8 pAb (ATL-HPA075970)
Datasheet Anti IGSF8 pAb (ATL-HPA075970) Datasheet (External Link)
Vendor Page Anti IGSF8 pAb (ATL-HPA075970) at Atlas Antibodies

Documents & Links for Anti IGSF8 pAb (ATL-HPA075970)
Datasheet Anti IGSF8 pAb (ATL-HPA075970) Datasheet (External Link)
Vendor Page Anti IGSF8 pAb (ATL-HPA075970)