Anti IGSF23 pAb (ATL-HPA054591)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054591-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: IGSF23
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040498: 53%, ENSRNOG00000024630: 47%
Entrez Gene ID: 147710
Uniprot ID: A1L1A6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YMCIATNSKKQLVSEPVTISLPKPIMQPTEAEPMEPDPTLSLSGGSAIGL |
| Gene Sequence | YMCIATNSKKQLVSEPVTISLPKPIMQPTEAEPMEPDPTLSLSGGSAIGL |
| Gene ID - Mouse | ENSMUSG00000040498 |
| Gene ID - Rat | ENSRNOG00000024630 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IGSF23 pAb (ATL-HPA054591) | |
| Datasheet | Anti IGSF23 pAb (ATL-HPA054591) Datasheet (External Link) |
| Vendor Page | Anti IGSF23 pAb (ATL-HPA054591) at Atlas Antibodies |
| Documents & Links for Anti IGSF23 pAb (ATL-HPA054591) | |
| Datasheet | Anti IGSF23 pAb (ATL-HPA054591) Datasheet (External Link) |
| Vendor Page | Anti IGSF23 pAb (ATL-HPA054591) |