Anti IGSF23 pAb (ATL-HPA054591)

Atlas Antibodies

Catalog No.:
ATL-HPA054591-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: immunoglobulin superfamily, member 23
Gene Name: IGSF23
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040498: 53%, ENSRNOG00000024630: 47%
Entrez Gene ID: 147710
Uniprot ID: A1L1A6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YMCIATNSKKQLVSEPVTISLPKPIMQPTEAEPMEPDPTLSLSGGSAIGL
Gene Sequence YMCIATNSKKQLVSEPVTISLPKPIMQPTEAEPMEPDPTLSLSGGSAIGL
Gene ID - Mouse ENSMUSG00000040498
Gene ID - Rat ENSRNOG00000024630
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IGSF23 pAb (ATL-HPA054591)
Datasheet Anti IGSF23 pAb (ATL-HPA054591) Datasheet (External Link)
Vendor Page Anti IGSF23 pAb (ATL-HPA054591) at Atlas Antibodies

Documents & Links for Anti IGSF23 pAb (ATL-HPA054591)
Datasheet Anti IGSF23 pAb (ATL-HPA054591) Datasheet (External Link)
Vendor Page Anti IGSF23 pAb (ATL-HPA054591)