Anti IGSF22 pAb (ATL-HPA037851)

Atlas Antibodies

Catalog No.:
ATL-HPA037851-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: immunoglobulin superfamily member 22
Gene Name: IGSF22
Alternative Gene Name: FLJ37794, IGFN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051985: 38%, ENSRNOG00000026087: 33%
Entrez Gene ID: 283284
Uniprot ID: Q8N9C0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKY
Gene Sequence VPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKY
Gene ID - Mouse ENSMUSG00000051985
Gene ID - Rat ENSRNOG00000026087
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IGSF22 pAb (ATL-HPA037851)
Datasheet Anti IGSF22 pAb (ATL-HPA037851) Datasheet (External Link)
Vendor Page Anti IGSF22 pAb (ATL-HPA037851) at Atlas Antibodies

Documents & Links for Anti IGSF22 pAb (ATL-HPA037851)
Datasheet Anti IGSF22 pAb (ATL-HPA037851) Datasheet (External Link)
Vendor Page Anti IGSF22 pAb (ATL-HPA037851)