Anti IGFL1 pAb (ATL-HPA014001)

Atlas Antibodies

Catalog No.:
ATL-HPA014001-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: IGF-like family member 1
Gene Name: IGFL1
Alternative Gene Name: UNQ644
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066756: 30%, ENSRNOG00000032940: 33%
Entrez Gene ID: 374918
Uniprot ID: Q6UW32
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSD
Gene Sequence TPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSD
Gene ID - Mouse ENSMUSG00000066756
Gene ID - Rat ENSRNOG00000032940
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IGFL1 pAb (ATL-HPA014001)
Datasheet Anti IGFL1 pAb (ATL-HPA014001) Datasheet (External Link)
Vendor Page Anti IGFL1 pAb (ATL-HPA014001) at Atlas Antibodies

Documents & Links for Anti IGFL1 pAb (ATL-HPA014001)
Datasheet Anti IGFL1 pAb (ATL-HPA014001) Datasheet (External Link)
Vendor Page Anti IGFL1 pAb (ATL-HPA014001)