Anti IGFBP5 pAb (ATL-HPA059827)

Atlas Antibodies

Catalog No.:
ATL-HPA059827-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: insulin like growth factor binding protein 5
Gene Name: IGFBP5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026185: 95%, ENSRNOG00000017206: 93%
Entrez Gene ID: 3488
Uniprot ID: P24593
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMV
Gene Sequence DRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMV
Gene ID - Mouse ENSMUSG00000026185
Gene ID - Rat ENSRNOG00000017206
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IGFBP5 pAb (ATL-HPA059827)
Datasheet Anti IGFBP5 pAb (ATL-HPA059827) Datasheet (External Link)
Vendor Page Anti IGFBP5 pAb (ATL-HPA059827) at Atlas Antibodies

Documents & Links for Anti IGFBP5 pAb (ATL-HPA059827)
Datasheet Anti IGFBP5 pAb (ATL-HPA059827) Datasheet (External Link)
Vendor Page Anti IGFBP5 pAb (ATL-HPA059827)
Citations for Anti IGFBP5 pAb (ATL-HPA059827) – 1 Found
Deng, Yu; Yang, Xu; Hua, Hongzhong; Zhang, Cong. IGFBP5 is Upregulated and Associated with Poor Prognosis in Colorectal Cancer. International Journal Of General Medicine. 15( 35966504):6485-6497.  PubMed