Anti IGFBP4 pAb (ATL-HPA066240)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066240-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: IGFBP4
Alternative Gene Name: BP-4, HT29-IGFBP, IBP4, IGFBP-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017493: 96%, ENSRNOG00000010635: 95%
Entrez Gene ID: 3487
Uniprot ID: P22692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE |
| Gene Sequence | EDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE |
| Gene ID - Mouse | ENSMUSG00000017493 |
| Gene ID - Rat | ENSRNOG00000010635 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IGFBP4 pAb (ATL-HPA066240) | |
| Datasheet | Anti IGFBP4 pAb (ATL-HPA066240) Datasheet (External Link) |
| Vendor Page | Anti IGFBP4 pAb (ATL-HPA066240) at Atlas Antibodies |
| Documents & Links for Anti IGFBP4 pAb (ATL-HPA066240) | |
| Datasheet | Anti IGFBP4 pAb (ATL-HPA066240) Datasheet (External Link) |
| Vendor Page | Anti IGFBP4 pAb (ATL-HPA066240) |