Anti IGFBP2 pAb (ATL-HPA077723)

Atlas Antibodies

Catalog No.:
ATL-HPA077723-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: insulin-like growth factor binding protein 2, 36kDa
Gene Name: IGFBP2
Alternative Gene Name: IBP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039323: 74%, ENSRNOG00000016957: 76%
Entrez Gene ID: 3485
Uniprot ID: P18065
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLRCYPHPGSELPLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDS
Gene Sequence GLRCYPHPGSELPLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDS
Gene ID - Mouse ENSMUSG00000039323
Gene ID - Rat ENSRNOG00000016957
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IGFBP2 pAb (ATL-HPA077723)
Datasheet Anti IGFBP2 pAb (ATL-HPA077723) Datasheet (External Link)
Vendor Page Anti IGFBP2 pAb (ATL-HPA077723) at Atlas Antibodies

Documents & Links for Anti IGFBP2 pAb (ATL-HPA077723)
Datasheet Anti IGFBP2 pAb (ATL-HPA077723) Datasheet (External Link)
Vendor Page Anti IGFBP2 pAb (ATL-HPA077723)
Citations for Anti IGFBP2 pAb (ATL-HPA077723) – 1 Found
Fredolini, Claudia; Byström, Sanna; Sanchez-Rivera, Laura; Ioannou, Marina; Tamburro, Davide; Pontén, Fredrik; Branca, Rui M; Nilsson, Peter; Lehtiö, Janne; Schwenk, Jochen M. Systematic assessment of antibody selectivity in plasma based on a resource of enrichment profiles. Scientific Reports. 2019;9(1):8324.  PubMed