Anti IGFBP1 pAb (ATL-HPA050640 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050640-25

• 

Protein Description: insulin-like growth factor binding protein 1
Gene Name: IGFBP1
Alternative Gene Name: AFBP, hIGFBP-1, IBP1, IGF-BP25, PP12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020429: 71%, ENSRNOG00000058780: 72%
Entrez Gene ID: 3484
Uniprot ID: P08833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQI
• Gene Sequence: SKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQI
• Gene ID - Mouse: ENSMUSG00000020429
• Gene ID - Rat: ENSRNOG00000058780
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.