Anti IGF2BP3 pAb (ATL-HPA002037)

Atlas Antibodies

Catalog No.: ATL-HPA002037-25

Protein Description: insulin-like growth factor 2 mRNA binding protein 3
Gene Name: IGF2BP3
Alternative Gene Name: CT98, IMP-3, IMP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029814: 95%, ENSRNOG00000009052: 94%
Entrez Gene ID: 10643
Uniprot ID: O00425
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQ
• Gene Sequence: VVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQ
• Gene ID - Mouse: ENSMUSG00000029814
• Gene ID - Rat: ENSRNOG00000009052
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IGF2BP3 pAb (ATL-HPA002037) – 1 Found

Bhargava, Shruti; Visvanathan, Abhirami; Patil, Vikas; Kumar, Anuj; Kesari, Santosh; Das, Saumitra; Hegde, Alangar S; Arivazhagan, Arimappamagan; Santosh, Vani; Somasundaram, Kumaravel. IGF2 mRNA binding protein 3 (IMP3) promotes glioma cell migration by enhancing the translation of RELA/p65. Oncotarget. 2017;8(25):40469-40485.