Anti IGF1 pAb (ATL-HPA048946)

Atlas Antibodies

Catalog No.:
ATL-HPA048946-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: insulin-like growth factor 1 (somatomedin C)
Gene Name: IGF1
Alternative Gene Name: IGF-I, IGF1A, IGFI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020053: 91%, ENSRNOG00000004517: 93%
Entrez Gene ID: 3479
Uniprot ID: P05019
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM
Gene Sequence CFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM
Gene ID - Mouse ENSMUSG00000020053
Gene ID - Rat ENSRNOG00000004517
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IGF1 pAb (ATL-HPA048946)
Datasheet Anti IGF1 pAb (ATL-HPA048946) Datasheet (External Link)
Vendor Page Anti IGF1 pAb (ATL-HPA048946) at Atlas Antibodies

Documents & Links for Anti IGF1 pAb (ATL-HPA048946)
Datasheet Anti IGF1 pAb (ATL-HPA048946) Datasheet (External Link)
Vendor Page Anti IGF1 pAb (ATL-HPA048946)
Citations for Anti IGF1 pAb (ATL-HPA048946) – 2 Found
Darmanis, Spyros; Cui, Tao; Drobin, Kimi; Li, Su-Chen; Öberg, Kjell; Nilsson, Peter; Schwenk, Jochen M; Giandomenico, Valeria. Identification of candidate serum proteins for classifying well-differentiated small intestinal neuroendocrine tumors. Plos One. 8(11):e81712.  PubMed
Tao, Anqi; Wang, Xing; Li, Cuiying. Effect of Lycopene on Oral Squamous Cell Carcinoma Cell Growth by Inhibiting IGF1 Pathway. Cancer Management And Research. 13( 33531840):723-732.  PubMed