Anti IGF1 pAb (ATL-HPA048946)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048946-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: IGF1
Alternative Gene Name: IGF-I, IGF1A, IGFI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020053: 91%, ENSRNOG00000004517: 93%
Entrez Gene ID: 3479
Uniprot ID: P05019
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM |
| Gene Sequence | CFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM |
| Gene ID - Mouse | ENSMUSG00000020053 |
| Gene ID - Rat | ENSRNOG00000004517 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IGF1 pAb (ATL-HPA048946) | |
| Datasheet | Anti IGF1 pAb (ATL-HPA048946) Datasheet (External Link) |
| Vendor Page | Anti IGF1 pAb (ATL-HPA048946) at Atlas Antibodies |
| Documents & Links for Anti IGF1 pAb (ATL-HPA048946) | |
| Datasheet | Anti IGF1 pAb (ATL-HPA048946) Datasheet (External Link) |
| Vendor Page | Anti IGF1 pAb (ATL-HPA048946) |
| Citations for Anti IGF1 pAb (ATL-HPA048946) – 2 Found |
| Darmanis, Spyros; Cui, Tao; Drobin, Kimi; Li, Su-Chen; Öberg, Kjell; Nilsson, Peter; Schwenk, Jochen M; Giandomenico, Valeria. Identification of candidate serum proteins for classifying well-differentiated small intestinal neuroendocrine tumors. Plos One. 8(11):e81712. PubMed |
| Tao, Anqi; Wang, Xing; Li, Cuiying. Effect of Lycopene on Oral Squamous Cell Carcinoma Cell Growth by Inhibiting IGF1 Pathway. Cancer Management And Research. 13( 33531840):723-732. PubMed |