Anti IFT74 pAb (ATL-HPA020247)

Atlas Antibodies

Catalog No.: ATL-HPA020247-25

Protein Description: intraflagellar transport 74
Gene Name: IFT74
Alternative Gene Name: CCDC2, CMG-1, CMG1, FLJ22621
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028576: 90%, ENSRNOG00000008075: 91%
Entrez Gene ID: 80173
Uniprot ID: Q96LB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELQGQLADYNMLVDKLNTNTEMEEVMNDYNMLKAQNDRETQSLDVIFTERQAKEKQIRSVEEEIEQEKQATDDIIKNMSFENQVKYLEMKTTNEKLLQE
• Gene Sequence: ELQGQLADYNMLVDKLNTNTEMEEVMNDYNMLKAQNDRETQSLDVIFTERQAKEKQIRSVEEEIEQEKQATDDIIKNMSFENQVKYLEMKTTNEKLLQE
• Gene ID - Mouse: ENSMUSG00000028576
• Gene ID - Rat: ENSRNOG00000008075
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IFT74 pAb (ATL-HPA020247) – 1 Found

Lv, Mingrong; Tang, Dongdong; Yu, Hui; Geng, Hao; Zhou, Yiling; Shao, Zhongmei; Li, Kuokuo; Gao, Yang; Guo, Senchao; Xu, Chuan; Tan, Qing; Liu, Chunyu; Guo, Rui; Wu, Huan; Duan, Zongliu; Zhang, Jingjing; Wang, Guanxiong; Hua, Rong; Fu, Feifei; Wang, Kai; Xu, Yuping; Zhou, Ping; Wei, Zhaolian; Zhang, Feng; Cao, Yunxia; He, Xiaojin. Novel FSIP2 Variants Induce Super-Length Mitochondrial Sheath and Asthenoteratozoospermia in Humans. International Journal Of Biological Sciences. 19(2):393-411.