Anti IFT20 pAb (ATL-HPA021376)

Atlas Antibodies

Catalog No.: ATL-HPA021376-25

Protein Description: intraflagellar transport 20
Gene Name: IFT20
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001105: 61%, ENSRNOG00000008891: 87%
Entrez Gene ID: 90410
Uniprot ID: Q8IY31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTHLLLTATVTPSEQNSSREPGWETAMAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDK
• Gene Sequence: MTHLLLTATVTPSEQNSSREPGWETAMAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDK
• Gene ID - Mouse: ENSMUSG00000001105
• Gene ID - Rat: ENSRNOG00000008891
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IFT20 pAb (ATL-HPA021376) – 3 Found

Bernabé-Rubio, Miguel; Andrés, Germán; Casares-Arias, Javier; Fernández-Barrera, Jaime; Rangel, Laura; Reglero-Real, Natalia; Gershlick, David C; Fernández, José J; Millán, Jaime; Correas, Isabel; Miguez, David G; Alonso, Miguel A. Novel role for the midbody in primary ciliogenesis by polarized epithelial cells. The Journal Of Cell Biology. 2016;214(3):259-73. 

Hua, Kiet; Ferland, Russell J. Fixation methods can differentially affect ciliary protein immunolabeling. Cilia. 6( 28352462):5. 

Mühlhans, Johanna; Brandstätter, Johann Helmut; Giessl, Andreas. The centrosomal protein pericentrin identified at the basal body complex of the connecting cilium in mouse photoreceptors. Plos One. 6(10):e26496.