Anti IFRD2 pAb (ATL-HPA068560)

Atlas Antibodies

SKU: ATL-HPA068560-100

• 
• 
• 

Protein Description: interferon-related developmental regulator 2
Gene Name: IFRD2
Alternative Gene Name: IFNRP, SKMc15, SM15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010048: 84%, ENSRNOG00000016150: 85%
Entrez Gene ID: 7866
Uniprot ID: Q12894
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CLACLESVFSRFYGLGGSSTSPVVPASLHGLLSAALQAWALLLTICPSTQISHILDRQLPRLPQLLSSESVNLRIAAGETIALLFE
• Gene Sequence: CLACLESVFSRFYGLGGSSTSPVVPASLHGLLSAALQAWALLLTICPSTQISHILDRQLPRLPQLLSSESVNLRIAAGETIALLFE
• Gene ID - Mouse: ENSMUSG00000010048
• Gene ID - Rat: ENSRNOG00000016150
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.