Anti IFRD1 pAb (ATL-HPA072413)

Atlas Antibodies

Catalog No.: ATL-HPA072413-25

Protein Description: interferon related developmental regulator 1
Gene Name: IFRD1
Alternative Gene Name: PC4, TIS7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001627: 97%, ENSRNOG00000050997: 96%
Entrez Gene ID: 3475
Uniprot ID: O00458
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKS
• Gene Sequence: ATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKS
• Gene ID - Mouse: ENSMUSG00000001627
• Gene ID - Rat: ENSRNOG00000050997
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.