Anti IFRD1 pAb (ATL-HPA072413)

Atlas Antibodies

SKU:
ATL-HPA072413-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: interferon related developmental regulator 1
Gene Name: IFRD1
Alternative Gene Name: PC4, TIS7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001627: 97%, ENSRNOG00000050997: 96%
Entrez Gene ID: 3475
Uniprot ID: O00458
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKS
Gene Sequence ATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKS
Gene ID - Mouse ENSMUSG00000001627
Gene ID - Rat ENSRNOG00000050997
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti IFRD1 pAb (ATL-HPA072413)
Datasheet Anti IFRD1 pAb (ATL-HPA072413) Datasheet (External Link)
Vendor Page Anti IFRD1 pAb (ATL-HPA072413) at Atlas Antibodies

Documents & Links for Anti IFRD1 pAb (ATL-HPA072413)
Datasheet Anti IFRD1 pAb (ATL-HPA072413) Datasheet (External Link)
Vendor Page Anti IFRD1 pAb (ATL-HPA072413)