Anti IFNLR1 pAb (ATL-HPA017319 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA017319-25

Protein Description: interferon, lambda receptor 1
Gene Name: IFNLR1
Alternative Gene Name: CRF2/12, IFNLR, IL-28R1, IL28RA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062157: 68%, ENSRNOG00000033984: 63%
Entrez Gene ID: 163702
Uniprot ID: Q8IU57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEAN
• Gene Sequence: FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEAN
• Gene ID - Mouse: ENSMUSG00000062157
• Gene ID - Rat: ENSRNOG00000033984
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IFNLR1 pAb (ATL-HPA017319 w/enhanced validation) – 4 Found

Read, Scott A; O'Connor, Kate S; Suppiah, Vijay; Ahlenstiel, Chantelle L E; Obeid, Stephanie; Cook, Kristina M; Cunningham, Anthony; Douglas, Mark W; Hogg, Philip J; Booth, David; George, Jacob; Ahlenstiel, Golo. Zinc is a potent and specific inhibitor of IFN-λ3 signalling. Nature Communications. 2017;8( 28513591):15245. 

Zahn, Sabine; Rehkämper, Claudia; Kümmerer, Beate M; Ferring-Schmidt, Sandra; Bieber, Thomas; Tüting, Thomas; Wenzel, Jörg. Evidence for a pathophysiological role of keratinocyte-derived type III interferon (IFNλ) in cutaneous lupus erythematosus. The Journal Of Investigative Dermatology. 2011;131(1):133-40. 

Read, Scott A; Wijaya, Ratna; Ramezani-Moghadam, Mehdi; Tay, Enoch; Schibeci, Steve; Liddle, Christopher; Lam, Vincent W T; Yuen, Lawrence; Douglas, Mark W; Booth, David; George, Jacob; Ahlenstiel, Golo. Macrophage Coordination of the Interferon Lambda Immune Response. Frontiers In Immunology. 10( 31798594):2674. 

Mallampalli, Rama K; Adair, Jessica; Elhance, Ajit; Farkas, Daniela; Chafin, Lexie; Long, Matthew E; De, Mithu; Mora, Ana L; Rojas, Mauricio; Peters, Victor; Bednash, Joseph S; Tsai, MuChun; Londino, James D. Interferon Lambda Signaling in Macrophages Is Necessary for the Antiviral Response to Influenza. Frontiers In Immunology. 12( 34899695):735576.