Anti IFNGR1 pAb (ATL-HPA063871)

Atlas Antibodies

Catalog No.: ATL-HPA063871-25

Protein Description: interferon gamma receptor 1
Gene Name: IFNGR1
Alternative Gene Name: CD119, IFNGR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020009: 54%, ENSRNOG00000012074: 53%
Entrez Gene ID: 3459
Uniprot ID: P15260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSL
• Gene Sequence: SSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSL
• Gene ID - Mouse: ENSMUSG00000020009
• Gene ID - Rat: ENSRNOG00000012074
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.