Anti IFNGR1 pAb (ATL-HPA063871)
Atlas Antibodies
- SKU:
- ATL-HPA063871-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: IFNGR1
Alternative Gene Name: CD119, IFNGR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020009: 54%, ENSRNOG00000012074: 53%
Entrez Gene ID: 3459
Uniprot ID: P15260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSL |
Gene Sequence | SSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSL |
Gene ID - Mouse | ENSMUSG00000020009 |
Gene ID - Rat | ENSRNOG00000012074 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IFNGR1 pAb (ATL-HPA063871) | |
Datasheet | Anti IFNGR1 pAb (ATL-HPA063871) Datasheet (External Link) |
Vendor Page | Anti IFNGR1 pAb (ATL-HPA063871) at Atlas Antibodies |
Documents & Links for Anti IFNGR1 pAb (ATL-HPA063871) | |
Datasheet | Anti IFNGR1 pAb (ATL-HPA063871) Datasheet (External Link) |
Vendor Page | Anti IFNGR1 pAb (ATL-HPA063871) |