Anti IFNB1 pAb (ATL-HPA073843)

Atlas Antibodies

Catalog No.:
ATL-HPA073843-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: interferon beta 1
Gene Name: IFNB1
Alternative Gene Name: IFB, IFF, IFNB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048806: 45%, ENSRNOG00000006268: 50%
Entrez Gene ID: 3456
Uniprot ID: P01574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN
Gene Sequence YNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN
Gene ID - Mouse ENSMUSG00000048806
Gene ID - Rat ENSRNOG00000006268
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IFNB1 pAb (ATL-HPA073843)
Datasheet Anti IFNB1 pAb (ATL-HPA073843) Datasheet (External Link)
Vendor Page Anti IFNB1 pAb (ATL-HPA073843) at Atlas Antibodies

Documents & Links for Anti IFNB1 pAb (ATL-HPA073843)
Datasheet Anti IFNB1 pAb (ATL-HPA073843) Datasheet (External Link)
Vendor Page Anti IFNB1 pAb (ATL-HPA073843)