Anti IFNAR1 pAb (ATL-HPA029226)

Atlas Antibodies

Catalog No.: ATL-HPA029226-25

Protein Description: interferon (alpha, beta and omega) receptor 1
Gene Name: IFNAR1
Alternative Gene Name: IFNAR, IFRC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022967: 49%, ENSRNOG00000028594: 37%
Entrez Gene ID: 3454
Uniprot ID: P17181
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV
• Gene Sequence: NISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV
• Gene ID - Mouse: ENSMUSG00000022967
• Gene ID - Rat: ENSRNOG00000028594
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.