Anti IFNAR1 pAb (ATL-HPA029226)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029226-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: IFNAR1
Alternative Gene Name: IFNAR, IFRC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022967: 49%, ENSRNOG00000028594: 37%
Entrez Gene ID: 3454
Uniprot ID: P17181
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV |
| Gene Sequence | NISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV |
| Gene ID - Mouse | ENSMUSG00000022967 |
| Gene ID - Rat | ENSRNOG00000028594 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IFNAR1 pAb (ATL-HPA029226) | |
| Datasheet | Anti IFNAR1 pAb (ATL-HPA029226) Datasheet (External Link) |
| Vendor Page | Anti IFNAR1 pAb (ATL-HPA029226) at Atlas Antibodies |
| Documents & Links for Anti IFNAR1 pAb (ATL-HPA029226) | |
| Datasheet | Anti IFNAR1 pAb (ATL-HPA029226) Datasheet (External Link) |
| Vendor Page | Anti IFNAR1 pAb (ATL-HPA029226) |