Anti IFNAR1 pAb (ATL-HPA018015)

Atlas Antibodies

Catalog No.: ATL-HPA018015-25

Protein Description: interferon (alpha, beta and omega) receptor 1
Gene Name: IFNAR1
Alternative Gene Name: IFNAR, IFRC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022967: 43%, ENSRNOG00000028594: 46%
Entrez Gene ID: 3454
Uniprot ID: P17181
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KWKQIPDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLN
• Gene Sequence: KWKQIPDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLN
• Gene ID - Mouse: ENSMUSG00000022967
• Gene ID - Rat: ENSRNOG00000028594
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IFNAR1 pAb (ATL-HPA018015) – 2 Found

Odnokoz, Olena; Yu, Pengfei; Peck, Amy R; Sun, Yunguang; Kovatich, Albert J; Hooke, Jeffrey A; Hu, Hai; Mitchell, Edith P; Rui, Hallgeir; Fuchs, Serge Y. Malignant cell-specific pro-tumorigenic role of type I interferon receptor in breast cancers. Cancer Biology & Therapy. 2020;21(7):629-636. 

Cho, Christina; Mukherjee, Riddhita; Peck, Amy R; Sun, Yunguang; McBrearty, Noreen; Katlinski, Kanstantsin V; Gui, Jun; Govindaraju, Priya K; Puré, Ellen; Rui, Hallgeir; Fuchs, Serge Y. Cancer-associated fibroblasts downregulate type I interferon receptor to stimulate intratumoral stromagenesis. Oncogene. 2020;39(38):6129-6137.