Anti IFIT5 pAb (ATL-HPA062180)

Atlas Antibodies

Catalog No.: ATL-HPA062180-25

Protein Description: interferon-induced protein with tetratricopeptide repeats 5
Gene Name: IFIT5
Alternative Gene Name: RI58
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079339: 37%, ENSRNOG00000036603: 39%
Entrez Gene ID: 24138
Uniprot ID: Q13325
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: THNRPKGKDKLKVDELISSAIFHFKAAMERDSMFAFAYTDLANMYAEGGQYSNAEDIFRKALRLENITDDHKHQIHYH
• Gene Sequence: THNRPKGKDKLKVDELISSAIFHFKAAMERDSMFAFAYTDLANMYAEGGQYSNAEDIFRKALRLENITDDHKHQIHYH
• Gene ID - Mouse: ENSMUSG00000079339
• Gene ID - Rat: ENSRNOG00000036603
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.