Anti IFIT2 pAb (ATL-HPA003408)

Atlas Antibodies

Catalog No.: ATL-HPA003408-25

Protein Description: interferon-induced protein with tetratricopeptide repeats 2
Gene Name: IFIT2
Alternative Gene Name: cig42, G10P2, GARG-39, IFI-54, IFI54, ISG-54K
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045932: 60%, ENSRNOG00000036604: 57%
Entrez Gene ID: 3433
Uniprot ID: P09913
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVCSILASLHALADQYEDAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGS
• Gene Sequence: RVCSILASLHALADQYEDAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGS
• Gene ID - Mouse: ENSMUSG00000045932
• Gene ID - Rat: ENSRNOG00000036604
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IFIT2 pAb (ATL-HPA003408) – 2 Found

Feng, Xiaoshan; Wang, Ying; Ma, Zhikun; Yang, Ruina; Liang, Shuo; Zhang, Mengxi; Song, Shiyuan; Li, Shuoguo; Liu, Gang; Fan, Daiming; Gao, Shegan. MicroRNA-645, up-regulated in human adencarcinoma of gastric esophageal junction, inhibits apoptosis by targeting tumor suppressor IFIT2. Bmc Cancer. 2014;14( 25174799):633. 

Mähönen, Katariina; Hau, Annika; Bondet, Vincent; Duffy, Darragh; Eklund, Kari K; Panelius, Jaana; Ranki, Annamari. Activation of NLRP3 Inflammasome in the Skin of Patients with Systemic and Cutaneous Lupus Erythematosus. Acta Dermato-Venereologica. 2022;102( 35356994):adv00708.