Anti IFIT1B pAb (ATL-HPA062924)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062924-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: IFIT1B
Alternative Gene Name: bA149I23.6, IFIT1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079339: 58%, ENSRNOG00000019050: 66%
Entrez Gene ID: 439996
Uniprot ID: Q5T764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RFQEHHGKSQDKAITHYLKGLKIEKMSHSREKLLNALEKLAKRCIHQNVR |
| Gene Sequence | RFQEHHGKSQDKAITHYLKGLKIEKMSHSREKLLNALEKLAKRCIHQNVR |
| Gene ID - Mouse | ENSMUSG00000079339 |
| Gene ID - Rat | ENSRNOG00000019050 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IFIT1B pAb (ATL-HPA062924) | |
| Datasheet | Anti IFIT1B pAb (ATL-HPA062924) Datasheet (External Link) |
| Vendor Page | Anti IFIT1B pAb (ATL-HPA062924) at Atlas Antibodies |
| Documents & Links for Anti IFIT1B pAb (ATL-HPA062924) | |
| Datasheet | Anti IFIT1B pAb (ATL-HPA062924) Datasheet (External Link) |
| Vendor Page | Anti IFIT1B pAb (ATL-HPA062924) |